PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI08G25210.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 262aa    MW: 29366.2 Da    PI: 7.7859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI08G25210.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.9e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++l+  +  +G  +W+++++  g+ R++k+c++rw +yl
  ORUFI08G25210.1 14 RGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding56.56.2e-1869111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        T++E++l vd++++lG++ W++Ia++++ gRt++++k++w+++
  ORUFI08G25210.1  69 LLTADEEQLVVDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                      569*****************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-22563IPR009057Homeodomain-like
PROSITE profilePS5129414.709961IPR017930Myb domain
SuperFamilySSF466893.74E-2712108IPR009057Homeodomain-like
SMARTSM007174.2E-131363IPR001005SANT/Myb domain
PfamPF002492.9E-151461IPR001005SANT/Myb domain
CDDcd001672.45E-101661No hitNo description
PROSITE profilePS5129428.16262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2564117IPR009057Homeodomain-like
SMARTSM007179.6E-1666114IPR001005SANT/Myb domain
PfamPF002491.6E-1569111IPR001005SANT/Myb domain
CDDcd001671.40E-1271112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MGRQPCCDKK KVKRGPWTAE EDKKLISFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TADEEQLVVD LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPATHQPLP NTKVVSQTRT STLSTATTES AKSNGMAYPF DPEGGCSRDM SVPTDSMEQS  180
SRNTSSHGLD PLVNWLLEAE LPADEPWLNF TSSNEDDFSG IVKQSAWDGS TTDWLLDYQD  240
FSMDDSSLID GARVQNSDGL NF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047040.0AP004704.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0544G09.
GenBankAP0062650.0AP006265.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1112_E06.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015650716.10.0PREDICTED: protein ODORANT1
RefseqXP_015650715.10.0PREDICTED: protein ODORANT1
RefseqXP_015650714.10.0PREDICTED: protein ODORANT1
SwissprotQ50EX62e-87ODO1_PETHY; Protein ODORANT1
TrEMBLA2YXT30.0A2YXT3_ORYSI; Putative uncharacterized protein
TrEMBLA0A0E0QM230.0A0A0E0QM23_ORYRU; Uncharacterized protein
TrEMBLQ6YSZ50.0Q6YSZ5_ORYSJ; Putative Myb13 protein
STRINGBGIOSGA026529-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22680.13e-82myb domain protein 85